- S100A16 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92361
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
- This antibody was developed against Recombinant Protein corresponding to amino acids: VIVLVENFYK YVSKYSLVKN KISKSSFREM LQKELNHMLS DTGNRKAADK LIQNLDANHD GRISFDEYWT LIGGITGPIA KLIHEQEQ
- S100A16
- Human
- 0.1 ml (also 25ul)
- AAG13, DT1P1A7, S100F
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- S100 calcium binding protein A16
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cell Cycle and Replication
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
VIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQ
Specifications/Features
Available conjugates: Unconjugated